General Information

  • ID:  hor001115
  • Uniprot ID:  Q867W1
  • Protein name:  SIFamide
  • Gene name:  NA
  • Organism:  Procambarus clarkii (Red swamp crayfish)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Olfactory lobe and accessory lobe, olfactory globular tract, olfactory lobe cells (at protein level). Widely distributed throughout nervous system.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Procambarus (genus), Cambarinae (subfamily), Cambaridae (family), Astacoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GYRKPPFNGSIFG
  • Length:  13(28-40)
  • Propeptide:  MCVQTRMLVAVAVVLVVLAVLSDPVSAGYRKPPFNGSIFGKRAGGDSLYEPGKALASACQVAVEACAAWFPGPEKK
  • Signal peptide:  MCVQTRMLVAVAVVLVVLAVLSDPVSA
  • Modification:  T12 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  GYRKPPFNGSIF-amide may be involved in olfaction and contraction of hindgut.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q867W1-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001115_AF2.pdbhor001115_ESM.pdb

Physical Information

Mass: 165384 Formula: C68H98N18O17
Absent amino acids: ACDEHLMQTVW Common amino acids: G
pI: 10.45 Basic residues: 2
Polar residues: 6 Hydrophobic residues: 3
Hydrophobicity: -63.85 Boman Index: -1695
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 30
Instability Index: 196.15 Extinction Coefficient cystines: 1490
Absorbance 280nm: 124.17

Literature

  • PubMed ID:  14723891
  • Title:  Identification of GYRKPPFNGSIFamide (crustacean-SIFamide) in the crayfish Procambarus clarkii by topological mass spectrometry analysis